Check Domain Expiry
Domain: yayasanshrikesariwarmadewa.info
Status: Registered
Registrar: N/A
WHOIS Server: N/A
Created: N/A
Updated: N/A
Expires: N/A
N/A
The domain yayasanshrikesariwarmadewa.info
was registered on
N/A
.
It is currently registered
and managed by an accredited registrar.
The domain belongs to the
info
top-level domain
and is configured with default nameservers.
This information helps verify domain ownership and plan timely renewals before expiration.
Raw WHOIS Data
% IANA WHOIS server % for more information on IANA, visit http://www.iana.org % This query returned 1 object refer: domain: INFO organisation: Identity Digital Limited address: c/o Identity Digital Inc. address: 10500 NE 8th Street, Suite 750 address: Bellevue WA 98004 address: United States of America (the) contact: administrative name: Vice President, Engineering organisation: Identity Digital Limited address: c/o Identity Digital Inc. address: 10500 NE 8th Street, Suite 750 address: Bellevue WA 98004 address: United States of America (the) phone: +1.425.298.2200 fax-no: +1.425.671.0020 e-mail: [email protected] contact: technical name: Senior Director, DNS Infrastructure Group organisation: Identity Digital Limited address: c/o Identity Digital Inc. address: 10500 NE 8th Street, Suite 750 address: Bellevue WA 98004 address: United States of America (the) phone: +1.425.298.2200 fax-no: +1.425.671.0020 e-mail: [email protected] nserver: A0.INFO.AFILIAS-NST.INFO 199.254.31.1 2001:500:19:0:0:0:0:1 nserver: A2.INFO.AFILIAS-NST.INFO 199.249.113.1 2001:500:41:0:0:0:0:1 nserver: B0.INFO.AFILIAS-NST.ORG 199.254.48.1 2001:500:1a:0:0:0:0:1 nserver: B2.INFO.AFILIAS-NST.ORG 199.249.121.1 2001:500:49:0:0:0:0:1 nserver: C0.INFO.AFILIAS-NST.INFO 199.254.49.1 2001:500:1b:0:0:0:0:1 nserver: D0.INFO.AFILIAS-NST.ORG 199.254.50.1 2001:500:1c:0:0:0:0:1 ds-rdata: 5104 8 2 1af7548a8d3e2950c20303757df9390c26cfa39e26c8b6a8f6c8b1e72dd8f744 whois: status: ACTIVE remarks: Registration information: https://www.identity.digital/ created: 2001-06-26 changed: 2025-09-04 source: IANA
Check whether a Domain Name is available for registration or not via our Domain Search Tool.
Use the WHOIS Information tool to find out a domain's owner, location, ip and other information.
Looking out for a domain name that you want to claim? Learn when a domain will expire with our whois & search tools.
yayasanshrikesariwarmadewa.info Whois information
What is a Whois domain tool?
A Whois domain tool is a query and response protocol that is used to get information about registered domain names. It provides data such as the domain's ownership, registration date, and expiry date.
Why is a Whois domain tool important?
A Whois domain tool is crucial as it aids in domain verification, helps trace domain name registrants, assists in resolving system issues, and helps law enforcement in investigations and trademark research.
How to use our Whois domain tool?
To use our Whois domain tool, simply enter the domain name in the provided search box and hit enter. The tool will then generate a comprehensive report about the domain.
Is the data provided by the Whois domain tool accurate?
Yes, the data provided by a Whois domain tool is accurate as it is extracted directly from domain registrars' databases. However, some information may be hidden if the domain owner uses a privacy service.
Can I check the availability of a domain using a Whois domain tool?
Yes, a Whois domain tool not only provides information about a registered domain but also lets you check the availability of a domain if you're looking to register one.
Is the use of a Whois domain tool free?
Yes, our Whois domain tool is free to use. It provides a fast, reliable, and comprehensive report about any domain name you enter, at no cost.